someone who is dazzlingly skilled in any field
an expert in soil management and field-crop production
a versatile person who is expert at many things
someone who is skilled at analyzing data
an expert who studies financial data (on credit or securities or sales or financial patterns etc.) and recommends appropriate business actions
an expert in anatomy
an expert or collector of antiquities
someone with the power to settle matters at will
a person who is expert in the use of a bow and arrow
an expert whose views are taken as definitive
a person who attained the rank of expert in the martial arts (judo or karate)
an expert who is highly skilled in obscure or difficult or esoteric matters
an expert at calculation (or at operating calculating machines)
someone who is expert in climatology
an authority on computers and computing
an expert in the use of cosmetics
an expert in increasing the efficient use of machines and personnel
a person skilled in exegesis (especially of religious texts)
an expert in genealogy
an expert on geography
an expert in the science of cultivating plants (fruit or flowers or vegetables or ornamental plants)
someone who investigates
a legal scholar versed in civil law or the law of nations
an expert on precious stones and the art of cutting and engraving them
a person skilled at symbolic logic
an expert in the use of mnemonics; someone able to perform unusual feats of memory
an expert on mythology
an intelligent but single-minded expert in a particular technical field or profession
an expert who observes and comments on something
someone who is excellent at something
an expert in parliamentary rules and procedures
someone who has long and thorough experience in a given activity
an expert in prosthetics
an expert in the study of ferns
someone who can find paths through unexplored territory
a person who is unusually skilled in certain ways
a person who shoots (usually with respect to their ability to shoot)
an expert who is devoted to one occupation or branch of learning
a person who possesses unusual innate ability in some field or activity
someone known for high skill in some intellectual or artistic technique
an expert who is a member of a highly skilled elite group
a person skilled in a particular type of therapy
an experienced person who has been through many battles; someone who has given long service
a specialist in wine making
a therapist who practices naprapathy
a person who adds numbers
one who investigates insurance claims or claims for damages and recommends an effective settlement
an expert who gives advice
a therapist who makes suffering more endurable
an analyst who studies the financial statements and financial history of applicants for credit in order to evaluate their creditworthiness
an analyst who studies the financial performance of corporations
an analyst of conditions affecting a particular industry
an analyst of conditions affecting a market (especially the stock market)
a commentator who writes notes to a text
an analyst who assays (performs chemical tests on) metals
a specialist assigned to the staff of a diplomatic mission
someone able to perform complex and lengthy calculations
a specialist in canon law
a person who makes maps
a therapist who practices chiropractic
anatomist who compares the anatomy of different animals
an expert able to appreciate a field; especially in the fine arts
a public official who investigates by inquest any death not due to natural causes
a specialist in criminology
a specialist in crystallography
a Mexican woman who practices healing techniques inherited from the Mayans
a Mexican man who practices healing techniques inherited from the Mayans
an investigator engaged or employed in obtaining information not easily available to the public
a logician skilled in dialectic
a specialist in the study of food, nourishment, and health
a specialist in the theory of education
someone who specializes in the treatment of disease by electricity
an authority who is able to estimate worth or quality
an investigator who observes carefully
a specialist in identifying fingerprints
someone who takes care of a garden
a specialist in the study of Germanic language or culture or literature
someone who specializes in graphic design
a specialist in inferring character from handwriting
anatomist who specializes in the microscopic study of animal tissues
a therapist who heals by the use of herbs
a preeminent authority or major proponent of a movement or doctrine
guide to people hunting in unfamiliar territory
a government analyst of information about an enemy or potential enemy
a person who specializes in designing architectural interiors and their furnishings
a specialist in the study of freshwater ponds and lakes
an authority on liturgies
a medieval English archer who used a longbow
someone skilled in shooting
an authority qualified to teach apprentices
a specialist who studies processes in the earth’s atmosphere that cause weather conditions
a jurist who interprets Muslim religious law
a therapist who practices naturopathy
a government appointee who investigates complaints by private persons against the government
a person skilled in testing for defects of vision in order to prescribe corrective glasses
a specialist in oriental subjects
an anatomist who is skilled is osteology
a therapist who manipulates the skeleton and muscles
therapist who treats injury or dysfunction with exercises and other physical treatments of the disorder
a therapist who deals with mental and emotional disorders
a traditional Zulu healer and respected elder
a person who shoots a gun (as regards their ability)
a therapist who treats speech defects and disorders
someone versed in the collection and interpretation of numerical data (especially someone who uses statistics to calculate insurance premiums)
a person who subtracts numbers
logician skilled in syllogistic reasoning
a person skilled at symbolic logic
a person skilled at systems analysis
a specialist in the history of the Teutonic people or language (especially with respect to the Teutonic influence on the history of England)
a star runner
someone who marks a trail by leaving blazes on trees
a person who engages in shooting at clay pigeons that are hurled into the air by a trap
a specialist in treating damaged trees
an expert on the UNIX operating system
An expert is somebody who has a broad and deep understanding and competence in terms of knowledge, skill and experience through practice and education in a particular field. Informally, an expert is someone widely recognized as a reliable source of technique or skill whose faculty for judging or deciding rightly, justly, or wisely is accorded authority and status by peers or the public in a specific well-distinguished domain. An expert, more generally, is a person with extensive knowledge or ability based on research, experience, or occupation and in a particular area of study. Experts are called in for advice on their respective subject, but they do not always agree on the particulars of a field of study. An expert can be believed, by virtue of credentials, training, education, profession, publication or experience, to have special knowledge of a subject beyond that of the average person, sufficient that others may officially (and legally) rely upon the individual’s opinion on that topic. Historically, an expert was referred to as a sage. The individual was usually a profound thinker distinguished for wisdom and sound judgment.
In specific fields, the definition of expert is well established by consensus and therefore it is not always necessary for individuals to have a professional or academic qualification for them to be accepted as an expert. In this respect, a shepherd with 50 years of experience tending flocks would be widely recognized as having complete expertise in the use and training of sheep dogs and the care of sheep. Another example from computer science is that an expert system may be taught by a human and thereafter considered an expert, often outperforming human beings at particular tasks. In law, an expert witness must be recognized by argument and authority.
Research in this area attempts to understand the relation between expert knowledge, skills and personal characteristics and exceptional performance. Some researchers have investigated the cognitive structures and processes of experts. The fundamental aim of this research is to describe what it is that experts know and how they use their knowledge to achieve performance that most people assume requires extreme or extraordinary ability. Studies have investigated the factors that enable experts to be fast and accurate.[1]
ExpertiseEdit
Expertise characteristics, skills and knowledge of a person (that is, expert) or of a system, which distinguish experts from novices and less experienced people. In many domains there are objective measures of performance capable of distinguishing experts from novices: expert chess players will almost always win games against recreational chess players; expert medical specialists are more likely to diagnose a disease correctly; etc.
The word expertise is used to refer also to expert determination, where an expert is invited to decide a disputed issue. The decision may be binding or advisory, according to the agreement between the parties in dispute.
Academic viewsEdit
There are two academic approaches to the understanding and study of expertise. The first understands expertise as an emergent property of communities of practice. In this view expertise is socially constructed; tools for thinking and scripts for action are jointly constructed within social groups enabling that group jointly to define and acquire expertise in some domain.
In the second view, expertise is a characteristic of individuals and is a consequence of the human capacity for extensive adaptation to physical and social environments. Many accounts of the development of expertise emphasize that it comes about through long periods of deliberate practice. In many domains of expertise estimates of 10 years’ experience[2] deliberate practice are common. Recent research on expertise emphasizes the nurture side of the nature and nurture argument.[2] Some factors not fitting the nature-nurture dichotomy are biological but not genetic, such as starting age, handedness, and season of birth.[3][4][5]
In the field of education there is a potential «expert blind spot» (see also Dunning–Kruger effect) in newly practicing educators who are experts in their content area. This is based on the «expert blind spot hypothesis» researched by Mitchell Nathan and Andrew Petrosino.[6] Newly practicing educators with advanced subject-area expertise of an educational content area tend to use the formalities and analysis methods of their particular area of expertise as a major guiding factor of student instruction and knowledge development, rather than being guided by student learning and developmental needs that are prevalent among novice learners.
The blind spot metaphor refers to the physiological blind spot in human vision in which perceptions of surroundings and circumstances are strongly impacted by their expectations. Beginning practicing educators tend to overlook the importance of novice levels of prior knowledge and other factors involved in adjusting and adapting pedagogy for learner understanding. This expert blind spot is in part due to an assumption that novices’ cognitive schemata are less elaborate, interconnected, and accessible than experts’ and that their pedagogical reasoning skills are less well developed.[7] Essential knowledge of subject matter for practicing educators consists of overlapping knowledge domains: subject matter knowledge and pedagogical content matter.[8] Pedagogical content matter consists of an understanding of how to represent certain concepts in ways appropriate to the learner contexts, including abilities and interests. The expert blind spot is a pedagogical phenomenon that is typically overcome through educators’ experience with instructing learners over time.[9][10]
Historical viewsEdit
In line with the socially constructed view of expertise, expertise can also be understood as a form of power; that is, experts have the ability to influence others as a result of their defined social status. By a similar token, a fear of experts can arise from fear of an intellectual elite’s power. In earlier periods of history, simply being able to read made one part of an intellectual elite. The introduction of the printing press in Europe during the fifteenth century and the diffusion of printed matter contributed to higher literacy rates and wider access to the once-rarefied knowledge of academia. The subsequent spread of education and learning changed society, and initiated an era of widespread education whose elite would now instead be those who produced the written content itself for consumption, in education and all other spheres.
Plato’s «Noble Lie», concerns expertise. Plato did not believe most people were clever enough to look after their own and society’s best interest, so the few clever people of the world needed to lead the rest of the flock. Therefore, the idea was born that only the elite should know the truth in its complete form and the rulers, Plato said, must tell the people of the city «the noble lie» to keep them passive and content, without the risk of upheaval and unrest.
In contemporary society, doctors and scientists, for example, are considered to be experts in that they hold a body of dominant knowledge that is, on the whole, inaccessible to the layman.[11] However, this inaccessibility and perhaps even mystery that surrounds expertise does not cause the layman to disregard the opinion of the experts on account of the unknown. Instead, the complete opposite occurs whereby members of the public believe in and highly value the opinion of medical professionals or of scientific discoveries,[11] despite not understanding it.
Edit
A number of computational models have been developed in cognitive science to explain the development from novice to expert. In particular, Herbert A. Simon and Kevin Gilmartin proposed a model of learning in chess called MAPP (Memory-Aided Pattern Recognizer).[12] Based on simulations, they estimated that about 50,000 chunks (units of memory) are necessary to become an expert, and hence the many years needed to reach this level. More recently, the CHREST model (Chunk Hierarchy and REtrieval STructures) has simulated in detail a number of phenomena in chess expertise (eye movements, performance in a variety of memory tasks, development from novice to expert) and in other domains.[13][14]
An important feature of expert performance seems to be the way in which experts are able to rapidly retrieve complex configurations of information from long-term memory. They recognize situations because they have meaning. It is perhaps this central concern with meaning and how it attaches to situations which provides an important link between the individual and social approaches to the development of expertise. Work on «Skilled Memory and Expertise» by Anders Ericsson and James J. Staszewski confronts the paradox of expertise and claims that people not only acquire content knowledge as they practice cognitive skills, they also develop mechanisms that enable them to use a large and familiar knowledge base efficiently.[1]
Work on expert systems (computer software designed to provide an answer to a problem, or clarify uncertainties where normally one or more human experts would need to be consulted) typically is grounded on the premise that expertise is based on acquired repertoires of rules and frameworks for decision making which can be elicited as the basis for computer supported judgment and decision-making. However, there is increasing evidence that expertise does not work in this fashion. Rather, experts recognize situations based on experience of many prior situations. They are in consequence able to make rapid decisions in complex and dynamic situations.
In a critique of the expert systems literature, Dreyfus & Dreyfus suggest:
If one asks an expert for the rules he or she is using, one will, in effect, force the expert to regress to the level of a beginner and state the rules learned in school. Thus, instead of using rules he or she no longer remembers, as the knowledge engineers suppose, the expert is forced to remember rules he or she no longer uses. … No amount of rules and facts can capture the knowledge an expert has when he or she has stored experience of the actual outcomes of tens of thousands of situations.[15]
Skilled memory theoryEdit
The role of long-term memory in the skilled memory effect was first articulated by Chase and Simon in their classic studies of chess expertise. They asserted that organized patterns of information stored in long-term memory (chunks) mediated experts’ rapid encoding and superior retention. Their study revealed that all subjects retrieved about the same number of chunks, but the size of the chunks varied with subjects’ prior experience. Experts’ chunks contained more individual pieces than those of novices. This research did not investigate how experts find, distinguish, and retrieve the right chunks from the vast number they hold without a lengthy search of long-term memory.
Skilled memory enables experts to rapidly encode, store, and retrieve information within the domain of their expertise and thereby circumvent the capacity limitations that typically constrain novice performance. For example, it explains experts’ ability to recall large amounts of material displayed for only brief study intervals, provided that the material comes from their domain of expertise. When unfamiliar material (not from their domain of expertise) is presented to experts, their recall is no better than that of novices.
The first principle of skilled memory, the meaningful encoding principle, states that experts exploit prior knowledge to durably encode information needed to perform a familiar task successfully. Experts form more elaborate and accessible memory representations than novices. The elaborate semantic memory network creates meaningful memory codes that create multiple potential cues and avenues for retrieval.
The second principle, the retrieval structure principle states that experts develop memory mechanisms called retrieval structures to facilitate the retrieval of information stored in long-term memory. These mechanisms operate in a fashion consistent with the meaningful encoding principle to provide cues that can later be regenerated to retrieve the stored information efficiently without a lengthy search.
The third principle, the speed up principle states that long-term memory encoding and retrieval operations speed up with practice, so that their speed and accuracy approach the speed and accuracy of short-term memory storage and retrieval.
Examples of skilled memory research described in the Ericsson and Stasewski study include:[1]
- a waiter who can accurately remember up to 20 complete dinner orders in an actual restaurant setting by using mnemonic strategy, patterns, and spatial relations (position of the person ordering). At the time of recall all items of a category (e.g., all salad dressings, then all meat temperatures, then all steak types, then all starch type) would be recalled in clockwise for all customers.
- a running enthusiast who grouped together short random sequences of digits and encoded the groups in terms of their meaning as running times, dates, and ages. He was thus able to recall over 84% of all digit groups presented in a session totaling 200–300 digits. His expertise was limited to digits; when a switch from digits to letters of the alphabet was made he exhibited no transfer—his memory span dropped back to about six consonants.
- math enthusiasts who can in less than 25 seconds mentally solve 2 × 5 digit multiplication problems (e.g., 23 × 48,856) that have been presented orally by the researcher.
In problem solvingEdit
Much of the research regarding expertise involves the studies of how experts and novices differ in solving problems.[16] Mathematics[17] and physics[18] are common domains for these studies.
One of the most cited works in this area examines how experts (PhD students in physics) and novices (undergraduate students that completed one semester of mechanics) categorize and represent physics problems. They found that novices sort problems into categories based upon surface features (e.g., keywords in the problem statement or visual configurations of the objects depicted). Experts, however, categorize problems based upon their deep structures (i.e., the main physics principle used to solve the problem).[19]
Their findings also suggest that while the schemas of both novices and experts are activated by the same features of a problem statement, the experts’ schemas contain more procedural knowledge which aid in determining which principle to apply, and novices’ schemas contain mostly declarative knowledge which do not aid in determining methods for solution.[19]
Germain’s scaleEdit
Relative to a specific field, an expert has:
- Specific education, training, and knowledge
- Required qualifications
- Ability to assess importance in work-related situations
- Capability to improve themselves
- Intuition
- Self-assurance and confidence in their knowledge
Marie-Line Germain developed a psychometric measure of perception of employee expertise called the Generalized Expertise Measure.[20] She defined a behavioral dimension in experts, in addition to the dimensions suggested by Swanson and Holton.[21] Her 16-item scale contains objective expertise items and subjective expertise items. Objective items were named Evidence-Based items. Subjective items (the remaining 11 items from the measure below) were named Self-Enhancement items because of their behavioral component.[20]
- This person has knowledge specific to a field of work.
- This person shows they have the education necessary to be an expert in the field.
- This person has the qualifications required to be an expert in the field.
- This person has been trained in their area of expertise.
- This person is ambitious about their work in the company.
- This person can assess whether a work-related situation is important or not.
- This person is capable of improving themselves.
- This person is charismatic.
- This person can deduce things from work-related situations easily.
- This person is intuitive in the job.
- This person is able to judge what things are important in their job.
- This person has the drive to become what they are capable of becoming in their field.
- This person is self-assured.
- This person has self-confidence.
- This person is outgoing.
RhetoricEdit
Scholars in rhetoric have also turned their attention to the concept of the expert. Considered an appeal to ethos or «the personal character of the speaker»,[22] established expertise allows a speaker to make statements regarding special topics of which the audience may be ignorant. In other words, the expert enjoys the deference of the audience’s judgment and can appeal to authority where a non-expert cannot.
In The Rhetoric of Expertise, E. Johanna Hartelius defines two basic modes of expertise: autonomous and attributed expertise. While an autonomous expert can «possess expert knowledge without recognition from other people,» attributed expertise is «a performance that may or may not indicate genuine knowledge.» With these two categories, Hartelius isolates the rhetorical problems faced by experts: just as someone with autonomous expertise may not possess the skill to persuade people to hold their points of view, someone with merely attributed expertise may be persuasive but lack the actual knowledge pertaining to a given subject. The problem faced by audiences follows from the problem facing experts: when faced with competing claims of expertise, what resources do non-experts have to evaluate claims put before them?[23]
Dialogic expertiseEdit
Hartelius and other scholars have also noted the challenges that projects such as Wikipedia pose to how experts have traditionally constructed their authority. In «Wikipedia and the Emergence of Dialogic Expertise», she highlights Wikipedia as an example of the «dialogic expertise» made possible by collaborative digital spaces. Predicated upon the notion that «truth emerges from dialogue», Wikipedia challenges traditional expertise both because anyone can edit it and because no single person, regardless of their credentials, can end a discussion by fiat. In other words, the community, rather than single individuals, direct the course of discussion. The production of knowledge, then, as a process of dialogue and argumentation, becomes an inherently rhetorical activity.[24]
Hartelius calls attention to two competing norm systems of expertise: “network norms of dialogic collaboration” and “deferential norms of socially sanctioned professionalism”; Wikipedia being evidence of the first.[25] Drawing on a Bakhtinian framework, Hartelius posits that Wikipedia is an example of an epistemic network that is driven by the view that individuals’ ideas clash with one another so as to generate expertise collaboratively.[25] Hartelius compares Wikipedia’s methodology of open-ended discussions of topics to that of Bakhtin’s theory of speech communication, where genuine dialogue is considered a live event, which is continuously open to new additions and participants.[25] Hartelius acknowledges that knowledge, experience, training, skill, and qualification are important dimensions of expertise but posits that the concept is more complex than sociologists and psychologists suggest.[25] Arguing that expertise is rhetorical, then, Hartelius explains that expertise «is not simply about one person’s skills being different from another’s. It is also fundamentally contingent on a struggle for ownership and legitimacy.»[25] Effective communication is an inherent element in expertise in the same style as knowledge is. Rather than leaving each other out, substance and communicative style are complementary.[25] Hartelius further suggests that Wikipedia’s dialogic construction of expertise illustrates both the instrumental and the constitutive dimensions of rhetoric; instrumentally as it challenges traditional encyclopedias and constitutively as a function of its knowledge production.[25] Going over the historical development of the encyclopedic project, Hartelius argues that changes in traditional encyclopedias have led to changes in traditional expertise. Wikipedia’s use of hyperlinks to connect one topic to another depends on, and develops, electronic interactivity meaning that Wikipedia’s way of knowing is dialogic.[25] Dialogic expertise then, emerges from multiple interactions between utterances within the discourse community.[25] The ongoing dialogue between contributors on Wikipedia not only results in the emergence of truth; it also explicates the topics one can be an expert of. As Hartelius explains, «the very act of presenting information about topics that are not included in traditional encyclopedias is a construction of new expertise.»[25] While Wikipedia insists that contributors must only publish preexisting knowledge, the dynamics behind dialogic expertise creates new information nonetheless. Knowledge production is created as a function of dialogue.[25] According to Hartelius, dialogic expertise has emerged on Wikipedia not only because of its interactive structure but also because of the site’s hortative discourse which is not found in traditional encyclopedias.[25] By Wikipedia’s hortative discourse, Hartelius means various encouragements to edit certain topics and instructions on how to do so that appear on the site.[25] One further reason to the emergence of dialogic expertise on Wikipedia is the site’s community pages, which function as a techne; explicating Wikipedia’s expert methodology.[25]
Networked expertiseEdit
Building on Hartelius, Damien Pfister developed the concept of «networked expertise». Noting that Wikipedia employs a «many to many» rather than a «one to one» model of communication, he notes how expertise likewise shifts to become a quality of a group rather than an individual. With the information traditionally associated with individual experts now stored within a text produced by a collective, knowing about something is less important than knowing how to find something. As he puts it, «With the internet, the historical power of subject matter expertise is eroded: the archival nature of the Web means that what and how to information is readily available.» The rhetorical authority previously afforded to subject matter expertise, then, is given to those with the procedural knowledge of how to find information called for by a situation.[26]
Contrasts and comparisonsEdit
Associated termsEdit
An expert differs from the specialist in that a specialist has to be able to solve a problem and an expert has to know its solution. The opposite of an expert is generally known as a layperson, while someone who occupies a middle grade of understanding is generally known as a technician and often employed to assist experts. A person may well be an expert in one field and a layperson in many other fields. The concepts of experts and expertise are debated within the field of epistemology under the general heading of expert knowledge. In contrast, the opposite of a specialist would be a generalist or polymath.
The term is widely used informally, with people being described as ‘experts’ in order to bolster the relative value of their opinion, when no objective criteria for their expertise is available. The term crank is likewise used to disparage opinions. Academic elitism arises when experts become convinced that only their opinion is useful, sometimes on matters beyond their personal expertise.
In contrast to an expert, a novice (known colloquially as a newbie or ‘greenhorn’) is any person that is new to any science or field of study or activity or social cause and who is undergoing training in order to meet normal requirements of being regarded a mature and equal participant.
«Expert» is also being mistakenly interchanged with the term «authority» in new media. An expert can be an authority if through relationships to people and technology, that expert is allowed to control access to his expertise. However, a person who merely wields authority is not by right an expert. In new media, users are being misled by the term «authority». Many sites and search engines such as Google and Technorati use the term «authority» to denote the link value and traffic to a particular topic. However, this authority only measures populist information. It in no way assures that the author of that site or blog is an expert.
An expert is not to be confused with a professional. A professional is someone who gets paid to do something. An amateur is the opposite of a professional, not the opposite of an expert.
Developmental characteristicsEdit
Some characteristics of the development of an expert have been found to include
- A characterization of this practice as «deliberate practice», which forces the practitioner to come up with new ways to encourage and enable themselves to reach new levels of performance[27]
- An early phase of learning which is characterized by enjoyment, excitement, and participation without outcome-related goals.[28]
- The ability to rearrange or construct a higher dimension of creativity. Due to such familiarity or advanced knowledge experts can develop more abstract perspectives of their concepts and/or performances.[27]
Use in literatureEdit
Mark Twain defined an expert as «an ordinary fellow from another town».[29] Will Rogers described an expert as «A man fifty miles from home with a briefcase.» Danish scientist and Nobel laureate Niels Bohr defined an expert as «A person that has made every possible mistake within his or her field.»[30] Malcolm Gladwell describes expertise as a matter of practicing the correct way for a total of around 10,000 hours.
See alsoEdit
- Perceptual learning
- Consultant – Professional who provides advice in their specific field of expertise
- Polymath – Individual whose knowledge spans a substantial number of subjects
GeneralEdit
- Scholar – Person who pursues academic and intellectual activities
- Know-how – Ability to do something
- Skill – Ability to carry out a task
- Competence – Ability of a person to do a job properly
- Technocracy – Form of government
- Tutor expertise in adult education
CriticismEdit
- Anti-intellectualism – Hostility to and mistrust of education, philosophy, art, literature, and science
- Denialism – Person’s choice to deny psychologically uncomfortable truth
- The Death of Expertise – Book by Tom Nichols
- Gibson’s law – Every PhD has an equal and opposite PhD
PsychologyEdit
- Dreyfus model of skill acquisition
- Dunning–Kruger effect – Cognitive bias about one’s own skill
- Pygmalion effect – Phenomenon in psychology
- Rational skepticism – Modern social movement based on the idea of scientific skepticism
ReferencesEdit
- ^ a b c Ericsson & Stasewski 1989.
- ^ a b Ericsson et al. 2006.
- ^ Gobet 2008.
- ^ Gobet & Chassy 2008.
- ^ Gobet & Campitelli 2007.
- ^ Nathan & Petrosino 2003, p. 906.
- ^ Borko & Livingston 1989, p. 474.
- ^ Borko et al. 1992, p. 195.
- ^ Borko & Livingston 1989.
- ^ Nathan & Petrosino 2003.
- ^ a b Fuller 2005, p. 141.
- ^ Simon & Gilmartin 1973.
- ^ Gobet & Simon 2000.
- ^ Gobet, de Voogt & Retschitzki 2004.
- ^ Dreyfus & Dreyfus 2005, p. 788.
- ^ Chi, Glasser & Rees 1982.
- ^ Sweller, Mawer & Ward 1983.
- ^ Chi, Feltovich & Glaser 1981.
- ^ a b Chi et al. 1981
- ^ a b Germain 2006a.
- ^ Swanson & Holton 2009.
- ^ Aristotle 2001.
- ^ Hartelius 2011.
- ^ Hartelius 2010.
- ^ a b c d e f g h i j k l m n Hartelius 2010, pp. 505–526.
- ^ Pfister 2011.
- ^ a b «Definition» Merriam-Webster.
- ^ Starkes & Ericsson 2003, p. 91.
- ^ Brady, Justin (June 25, 2014). «The troubling flaws in how we select experts». The Washington Post. Retrieved 10 November 2021.
- ^ Coughlan 1954.
BibliographyEdit
- Aristotle (2001). «Rhetoric». In McKeon, Richard (ed.). The Basic Works of Aristotle. Translated by Roberts, W. Rhys. New York: Modern Library. ISBN 0375757996.
- Borko, Hilda; Eisenhart, Margaret; Brown, Catherine A.; Underhill, Robert G.; Jones, Doug; Agard, Patricia C. (1992). «Learning to Teach Hard Mathematics: Do Novice Teachers and Their Instructors Give up Too Easily?» (PDF). Journal for Research in Mathematics Education. National Council of Teachers of Mathematics. 23 (3): 194–222. doi:10.5951/jresematheduc.23.3.0194. ISSN 0021-8251.
- Borko, Hilda; Livingston, Carol (1989). «Cognition and Improvisation: Differences in Mathematics Instruction by Expert and Novice Teachers». American Educational Research Journal. Winter 1989, Vol. 26, No. 4 (4): 473–498. doi:10.3102/00028312026004473. JSTOR 1162861. S2CID 145280199.
- Chase, W.G.; Simon, Herbert A. (1973a). «The mind’s eye in chess». In W.G. Chase (ed.). Visual information processing. New York: Academic Press. ISBN 978-0-12-170150-5.
- Chase, W.G.; Simon, Herbert A. (1973b). «Perception in chess». Cognitive Psychology. 4: 55–81. doi:10.1016/0010-0285(73)90004-2.
- Chi, M. T.; Feltovich, P. J.; Glaser, R. (1981). «Categorization and representation of physics problems by experts and novices». Cognitive Science. 5 (2): 121–152. doi:10.1207/s15516709cog0502_2.
- Chi, M. T. H.; Glasser, R.; Rees, E. (1982). «Expertise in problem solving». In Sternberg, R. J. (ed.). Advances in the psychology of human intelligence. Vol. 1. Hillsdale, NJ: Erlbaum. pp. 7–75.
- Collins, R. (1979). The Credential Society
- Coughlan, Robert (1954-09-06). «Dr. Edward Teller’s Magnificent Obsession». Life Magazine. Quoted by Dr Edward Teller. Retrieved 13 February 2017.
- «Definition of EXPERT». Merriam Webster Online. Retrieved 2019-10-11.
{{cite web}}
: CS1 maint: url-status (link) - Dewey, J. (1927). The Public and its Problems
- Dreyfus, H.; Dreyfus, S. (2005). «Expertise in real world contexts» (PDF). Organization Studies. 26 (5): 779–792. CiteSeerX 10.1.1.471.180. doi:10.1177/0170840605053102. S2CID 145718063. Archived from the original (PDF) on 2017-09-22. Retrieved 2017-10-26.
- Ericsson, K. A. (2000). Expert Performance and Deliberate Practice
- Ericsson, Anders K.; Charness, Neil; Feltovich, Paul; Hoffman, Robert R. (2006). Cambridge handbook on expertise and expert performance. Cambridge, UK: Cambridge University Press. ISBN 978-0-521-60081-1.
- Ericsson, Anders K.; Prietula, Michael J.; Cokely, Edward T. (2007). «The Making of an Expert». Harvard Business Review. 85 (July–August 2007): 114–21, 193. PMID 17642130.
- Ericsson, Anders K.; Stasewski, James J. (1989). «Chapter 9: Skilled Memory and Expertise: Mechanisms of Exceptional Performance». In David Klahr; Kenneth Kotovsky (eds.). Complex Information Processing: The Impact of Herbert A. Simon. Hillesdale N.J.: Lawrence Erlbaum Associates.
- Fuller, Steve (2005). The Intellectual. Icon Books. p. 141. ISBN 9781840467215.
- Germain, M.-L. (2005). Apperception and self-identification of managerial and subordinate expertise. Academy of Human Resource Development. Estes Park, CO. February 24–27.
- Germain, M.-L. (2006a), Development and preliminary validation of a psychometric measure of expertise: The Generalized Expertise Measure (GEM) (Unpublished Doctoral Dissertation), Barry University, Florida
- Germain, M.-L. (2006b). Perception of Instructors’ Expertise by College Students: An Exploratory Qualitative Research Study. American Educational Research Association annual conference, San Francisco, CA. April 7–11.
- Germain, M.-L. (2006c). What experts are not: Factors identified by managers as disqualifiers for selecting subordinates for expert team membership. Academy of Human Resource Development Conference. Columbus, OH. February 22–26.
- Germain, M.-L. (2009). The impact of perceived administrators’ expertise on subordinates’ job satisfaction and turnover intention. Academy of Human Resource Development. Arlington, VA. February 18–22.
- Germain, M.-L., & Tejeda, M. J. (2012). A preliminary exploration on the measurement of expertise: An initial development of a psychometric scale. Human Resource Development Quarterly, 23, no. 2, 203–232. doi:10.1002/hrdq.21134.
- Gibbons, M. (1994). Visual information processing. London: SAGE Publications. ISBN 978-0-8039-7794-5.
- Gobet, Fernand (2008). «The role of deliberate practice in expertise: Necessary but not sufficient». bura.brunel.ac.uk. Retrieved June 16, 2010.
{{cite web}}
: CS1 maint: url-status (link) - Gobet, F.; Campitelli, G. (2007). «The role of domain-specific practice, handedness and starting age in chess» (PDF). Developmental Psychology. 43 (1): 159–172. doi:10.1037/0012-1649.43.1.159. PMID 17201516.
- Gobet, F.; Chassy, P. (2008). «Season of birth and chess expertise» (PDF). Journal of Biosocial Science. 40 (2): 313–316. doi:10.1017/S0021932007002222. PMID 18335581. S2CID 10033606. Archived from the original (PDF) on 2011-07-18. Retrieved 2011-07-03.
- Gobet, F. (2015). Understanding expertise: A multi-disciplinary approach. London, UK: Palgrave/Macmilland. ISBN 9780230276246.
- Gobet, F.; de Voogt, A. J.; Retschitzki, J. (2004). Moves in mind: The psychology of board games. Hove, UK: Psychology Press. ISBN 978-1-84169-336-1.
- Gobet, F.; Simon, Herbert A. (2000). «Five seconds or sixty? Presentation time in expert memory» (PDF). Cognitive Science. 24 (4): 651–682. doi:10.1207/s15516709cog2404_4. S2CID 10577260.
- Goldman, A. I. (1999). Knowledge in a Social World[dead link]. Oxford: Oxford University Press.
- Hartelius, E. Johanna (2010-11-09). «Wikipedia and the Emergence of Dialogic Expertise». Southern Communication Journal. Informa UK Limited. 75 (5): 505–526. doi:10.1080/10417940903377169. ISSN 1041-794X. S2CID 144862927.
- Hartelius, E. Johanna (2011), The Rhetoric of Expertise, Lanham: Lexington
- Kitsikis, Dimitri, Le rôle des experts à la Conférence de la Paix. Gestation d’une technocratie en politique internationale. Ottawa, Editions de l’Université d’Ottawa, 1972, 227 pages.
- Mieg, Harald A. (2001). The social psychology of expertise. Mahwah, NJ: Lawrence Erlbaum Associates.
- Nathan, M.J.; Petrosino, A. (2003). «Expert Blind Spot Among Preservice Teachers» (PDF). American Educational Research Journal. Winter 2003, Vol. 40 (4): 905–928. doi:10.3102/00028312040004905. S2CID 145129059. Archived from the original (PDF) on 2015-04-24.
- Nettleton, S.; Burrows, R.; O’Malley, L. (2005). «The mundane realities of the everyday use of the internet for health, and their consequences for media convergence». Sociology of Health and Illness. 27 (7): 972–992. doi:10.1111/j.1467-9566.2005.00466.x. PMID 16313525.
- Pfister, Damien Smith (2011). «Networked Expertise in the Era of Many-to-many Communication: On Wikipedia and Invention». Social Epistemology. Informa UK Limited. 25 (3): 217–231. doi:10.1080/02691728.2011.578306. ISSN 0269-1728. S2CID 17067499.
- Shanteau, J.; Weiss, D.J.; Thomas, R.P.; Pounds, J.C. (2002). «Performance-based assessment of expertise: How to decide if someone is an expert or not». European Journal of Operational Research. 136 (2): 253–263. doi:10.1016/S0377-2217(01)00113-8.
- Simon, H. A.; Chase, W.G. (1973). «Skill in chess». American Scientist. 61 (4): 394–403. Bibcode:1973AmSci..61..394S.
- Simon, H. A.; Gilmartin, K. J. (1973). «A simulation of memory for chess positions». Cognitive Psychology. 5: 29–46. doi:10.1016/0010-0285(73)90024-8.
- Sowell, T. (1980). Knowledge and decisions. New York: Basic Books, Inc.
- Starkes, J.L.; Ericsson, K.A. (2003). Expert Performance in Sports: Advances in Research on Sport Expertise. Human Kinetics. ISBN 978-0-7360-4152-2. Retrieved 2022-06-15.
- Swanson, Richard A.; Holton, Elwood F., III (2009). Foundations of human resource development (PDF). San Francisco: Berrett-Kohler Publishers. ISBN 978-1-57675-803-8. OCLC 489195461.
- Sweller, J.; Mawer, R. F.; Ward, M. R. (1983). «Development of expertise in mathematical problem solving». Journal of Experimental Psychology. 112 (4): 639–661. doi:10.1037/0096-3445.112.4.639.
- Tynjälä, Päivi (1999). «Towards expert knowledge? A comparison between a constructivist and a traditional learning environment in the university». International Journal of Educational Research. 31 (5): 357–442. CiteSeerX 10.1.1.58.2038. doi:10.1016/S0883-0355(99)00012-9. S2CID 18750105.
Further readingEdit
Look up expert in Wiktionary, the free dictionary.
Look up expertise in Wiktionary, the free dictionary.
Wikiquote has quotations related to Expert.
- Books and publications
- Brint, Steven. 1994. In an Age of Experts: The Changing Roles of Professionals in Politics and Public Life. Princeton University Press.
- Ikujiro Nonaka, Georg von Krogh, and Sven Voelpel, Organizational Knowledge Creation Theory: Evolutionary Paths and Future Advances. Organization Studies, Vol. 27, No. 8, 1179-1208 (2006). SAGE Publications, 2006. DOI 10.1177/0170840606066312
- Sjöberg, Lennart (2001). «Limits of Knowledge and the Limited Importance of Trust» (PDF). Risk Analysis. 21 (1): 189–198. CiteSeerX 10.1.1.321.4451. doi:10.1111/0272-4332.211101. PMID 11332547. S2CID 17549251. Archived from the original (PDF) on 2017-08-08. Retrieved 2017-10-24.
- Hofer, Barbara K.; Pintrich, Paul R. (1997). «The Development of Epistemological Theories: Beliefs about Knowledge and Knowing and Their Relation to Learning». Review of Educational Research. 67 (1): 88–140. doi:10.2307/1170620. JSTOR 1170620.
- B Wynne, May the sheep safely graze? A reflexive view of the expert-lay knowledge divide. Risk, Environment and Modernity: Towards a New Ecology, 1996.
- Thomas H. Davenport, et al., Working knowledge . 1998, knowledge.hut.fi.
- Mats Alvesson, Knowledge work: Ambiguity, image and identity. Human Relations, Vol. 54, No. 7, 863-886 (2001). The Tavistock Institute, 2001.
- Peter J. Laugharne, Parliament and Specialist Advice, Manutius Press, 1994.
- Jay Liebowitz, Knowledge Management Handbook. CRC Press, 1999. 328 pages. ISBN 0-8493-0238-2
- C. Nadine Wathen and Jacquelyn Burkell, Believe it or not: Factors influencing credibility on the Web. Journal of the American Society for Information Science and Technology, VL. 53, NO. 2. PG 134–144. John Wiley & Sons, Inc., 2002. DOI 10.1002/asi.10016
- Nico Stehr, Knowledge Societies. Sage Publications, 1994. 304 pages. ISBN 0-8039-7892-8
- Patents
- U.S. Patent 4,803,641, Basic expert system tool, Steven Hardy et al., Filed November 25, 1987, Issued February 7, 1989.
ex·pert
(ĕk′spûrt′)
n.
A person with a high degree of skill in or knowledge of a certain subject.
adj. (ĕk′spûrt, ĭk-spûrt′)
Having, involving, or demonstrating skill in or knowledge of a certain subject. See Synonyms at proficient.
[Middle English, from Old French, experienced, from Latin expertus, past participle of experīrī, to try; see per- in Indo-European roots.]
ex′pert′ly adv.
ex′pert′ness n.
American Heritage® Dictionary of the English Language, Fifth Edition. Copyright © 2016 by Houghton Mifflin Harcourt Publishing Company. Published by Houghton Mifflin Harcourt Publishing Company. All rights reserved.
expert
(ˈɛkspɜːt)
n
a person who has extensive skill or knowledge in a particular field
adj
1. skilful or knowledgeable
2. of, involving, or done by an expert: an expert job.
[C14: from Latin expertus known by experience, from experīrī to test; see experience]
ˈexpertly adv
ˈexpertness n
Collins English Dictionary – Complete and Unabridged, 12th Edition 2014 © HarperCollins Publishers 1991, 1994, 1998, 2000, 2003, 2006, 2007, 2009, 2011, 2014
ex•pert
(ˈɛk spɜrt; adj. also ɪkˈspɜrt)
n.
1. a person who has special skill or knowledge in a particular field.
adj.
2. possessing special skill or knowledge.
3. pertaining to or characteristic of an expert: expert advice.
[1325–75; Middle English < Latin expertus, past participle of experīrī to try, test]
ex•pert′ly, adv.
ex•pert′ness, n.
Random House Kernerman Webster’s College Dictionary, © 2010 K Dictionaries Ltd. Copyright 2005, 1997, 1991 by Random House, Inc. All rights reserved.
See also related terms for try.
Farlex Trivia Dictionary. © 2012 Farlex, Inc. All rights reserved.
ThesaurusAntonymsRelated WordsSynonymsLegend:
Noun | 1. | adept, hotshot, maven, mavin, superstar, virtuoso, whiz, whizz, wiz, wizard, sensation, star, ace, genius, champion — someone who is dazzlingly skilled in any field agronomist — an expert in soil management and field-crop production all arounder, all-rounder — a versatile person who is expert at many things; «she’s the best all-rounder they’ve seen in years» analyst — someone who is skilled at analyzing data analyst — an expert who studies financial data (on credit or securities or sales or financial patterns etc.) and recommends appropriate business actions arbiter, supreme authority — someone with the power to settle matters at will; «she was the final arbiter on all matters of fashion» archer, bowman — a person who is expert in the use of a bow and arrow authority — an expert whose views are taken as definitive; «he is an authority on corporate law» black belt — a person who attained the rank of expert in the martial arts (judo or karate) kabbalist, cabalist — an expert who is highly skilled in obscure or difficult or esoteric matters exegete — a person skilled in exegesis (especially of religious texts) horticulturist, plantsman — an expert in the science of cultivating plants (fruit or flowers or vegetables or ornamental plants) jurist, legal expert — a legal scholar versed in civil law or the law of nations lapidarist, lapidary — an expert on precious stones and the art of cutting and engraving them mnemonist — an expert in the use of mnemonics; someone able to perform unusual feats of memory nerd — an intelligent but single-minded expert in a particular technical field or profession out-and-outer — someone who is excellent at something parliamentarian — an expert in parliamentary rules and procedures past master — someone who has long and thorough experience in a given activity pathfinder, scout, guide — someone who can find paths through unexplored territory shark — a person who is unusually skilled in certain ways; «a card shark» shooter, shot — a person who shoots (usually with respect to their ability to shoot); «he is a crack shot»; «a poor shooter» talent — a person who possesses unusual innate ability in some field or activity technician — someone known for high skill in some intellectual or artistic technique technocrat — an expert who is a member of a highly skilled elite group healer, therapist — a person skilled in a particular type of therapy |
Adj. | 1. | skilled — having or showing or requiring special skill; «only the most skilled gymnasts make an Olympic team»; «a skilled surgeon has many years of training and experience»; «a skilled reconstruction of her damaged elbow»; «a skilled trade» |
2. | expert — of or relating to or requiring special knowledge to be understood; «technical terminology»; «a technical report»; «technical language»
skilled — having or showing or requiring special skill; «only the most skilled gymnasts make an Olympic team»; «a skilled surgeon has many years of training and experience»; «a skilled reconstruction of her damaged elbow»; «a skilled trade» |
Based on WordNet 3.0, Farlex clipart collection. © 2003-2012 Princeton University, Farlex Inc.
expert
noun
1. specialist, authority, professional, master, pro (informal), ace (informal), genius, guru, pundit, buff (informal), wizard, adept, whizz (informal), maestro, virtuoso, connoisseur, boffin (Brit. informal), hotshot (informal), rocket scientist (informal, chiefly U.S.), past master, dab hand (Brit. informal), wonk (informal), maven (U.S.), fundi (S. African) an expert in computer graphics
specialist amateur, novice, layman, dabbler, nonprofessional, ham
adjective
1. skilful, trained, experienced, able, professional, skilled, master, masterly, qualified, talented, outstanding, clever, practised, accomplished, handy, competent, tasty (Brit. informal), apt, adept, knowledgeable, virtuoso, deft, proficient, facile, adroit, dexterous The faces of the waxworks are modelled by expert sculptors.
skilful inexperienced, incompetent, clumsy, unskilled, unqualified, untrained, amateurish, cack-handed (informal), unpractised
Quotations
«An expert is a man who has made all the mistakes which can be made in a very narrow field» [Niels Henrik David Bohr]
«An expert is one who knows more and more about less and less» [Nicholas Murray Butler]
«An expert is someone who knows some of the worst mistakes that can be made in his subject and who manages to avoid them» [Werner Heisenberg Der Teil und das Ganze]
Collins Thesaurus of the English Language – Complete and Unabridged 2nd Edition. 2002 © HarperCollins Publishers 1995, 2002
expert
noun
A person with a high degree of knowledge or skill in a particular field:
Chiefly British: dab.
adjective
Having or demonstrating a high degree of knowledge or skill:
The American Heritage® Roget’s Thesaurus. Copyright © 2013, 2014 by Houghton Mifflin Harcourt Publishing Company. Published by Houghton Mifflin Harcourt Publishing Company. All rights reserved.
Translations
odborníkodbornýzkušenýznalecexpert
ekspertekspert-fagmandsagkyndig
asjatundjaekspert
asiantuntijaeksperttitaitavaasiantunteva
stručnjakznalacekspert
szakavatott
reyndur; mjög fær, snjallsérfræîingur
専門家専門的な熟練者
전문가
įgudimasprityręssu įgudimu
eksperta-, lietpratēja-eksperts, lietpratējslietpratīgsspeciālists
strokovnjak
expertexpert-sakkunnig
ผู้เชี่ยวชาญ
chuyên gia
Collins Spanish Dictionary — Complete and Unabridged 8th Edition 2005 © William Collins Sons & Co. Ltd. 1971, 1988 © HarperCollins Publishers 1992, 1993, 1996, 1997, 2000, 2003, 2005
expert
[ˈɛkspɜːrt]
adj
[person] → expert(e)
He’s an expert cook
BUT Il cuisine très bien.
to be expert at doing sth → être spécialiste de qch
[opinion, help] → d’un expert expert witness
Collins English/French Electronic Resource. © HarperCollins Publishers 2005
expert
n → Experte m, → Expertin f; (= professional) → Fachmann m, → Fachfrau f; (Jur) → Sachverständige(r) mf; he is an expert on the subject/at that sort of negotiation → er ist Fachmann or Experte auf diesem Gebiet/für solche Verhandlungen; expert in geology → Fachmann m → /Fachfrau f → für Geologie, Geologieexperte m → /-expertin f; an expert at chess → ein Schachexperte m, → eine Schachexpertin; she is an expert on wines/oriental philosophy → sie ist eine Weinexpertin/eine Expertin auf dem Gebiet der orientalischen Philosophie; with the eye of an expert → mit fachmännischem Blick; to get the advice of experts → Experten/Sachverständige zurate or zu Rate ziehen; expert’s report → Sachverständigenbericht m, → Gutachten nt; OK, you do it, you’re the expert → gut, machen Sies, Sie sind der Fachmann; he’s an expert at saying the wrong thing (iro) → er versteht es meisterhaft, genau das Falsche zu sagen
Collins German Dictionary – Complete and Unabridged 7th Edition 2005. © William Collins Sons & Co. Ltd. 1980 © HarperCollins Publishers 1991, 1997, 1999, 2004, 2005, 2007
expert
[ˈɛkspɜːt]
1. adj (gen) → esperto/a; (advice, help) → da esperto
expert in or at doing sth → esperto/a nel fare qc
2. n → esperto/a
an expert on sth/in or at doing sth → un(a) esperto/a di qc/nel fare qc
Collins Italian Dictionary 1st Edition © HarperCollins Publishers 1995
expert
(ˈekspəːt) adjective
(with at or on) skilled through training or practice. an expert car designer; I’m expert at map-reading; Get expert advice on plumbing.
noun
a person who is an expert. an expert in political history / on ancient pottery.
ˈexpertly adverbˈexpertness noun
Kernerman English Multilingual Dictionary © 2006-2013 K Dictionaries Ltd.
expert
→ خَبِير odborník ekspert Experte ειδικός experto asiantuntija expert stručnjak esperto 専門家 전문가 expert ekspert fachowiec perito эксперт expert ผู้เชี่ยวชาญ uzman chuyên gia 专家
Multilingual Translator © HarperCollins Publishers 2009
expert
a. experto-a, perito-a.
English-Spanish Medical Dictionary © Farlex 2012
expert
adj & n experto -ta mf, especialista mf; — opinion opinión f de expertos
English-Spanish/Spanish-English Medical Dictionary Copyright © 2006 by The McGraw-Hill Companies, Inc. All rights reserved.
Recent Examples on the Web
What about other experts?
—Kenny Jacoby, USA TODAY, 31 Mar. 2023
Along with other experts at the Good Housekeeping Institute, she’s been testing the Loftie alarm clock in her bedroom for the past few weeks, falling asleep to crickets (not car horns) and waking up with a smile on her face to a peaceful gong.
—Good Housekeeping, 31 Mar. 2023
For instance, experts said the decision would not overturn coverage for preventive women’s health services that were approved outside the task force.
—Paul J. Weber, Fortune, 31 Mar. 2023
The forest fire that that broke out last Thursday near the village of Villanueva de Viver surprised Rubio and fire experts by displaying an unusual ferocity for spring, when in previous years lower temperatures helped keep fires manageable.
—Joseph Wilson, ajc, 30 Mar. 2023
The jury also heard from witnesses on the mountain with Paltrow and Sanderson that day, such as Craig Ramon and Deer Valley Resort ski instructor Eric Christiansen, as well as experts who investigated the collision.
—Tommy Mcardle, Peoplemag, 30 Mar. 2023
But tethering your heart to software comes with severe risks, computer science and public health experts said.
—Pranshu Verma, Washington Post, 30 Mar. 2023
The meeting reflected a move by some gunmakers at the time to strike licensing agreements with gaming firms to feature certain firearms, according to lawyers and experts, along with interviews and documents obtained by The Post.
—Todd C. Frankel, Shawn Boburg, Josh Dawsey, Ashley Parker And Alex Horton, The Washington Post, Anchorage Daily News, 30 Mar. 2023
And on April 7, the gallery will screen Riggs’ whimsical 1931 film A Day in Santa Fe, followed by a panel discussion with Smith and other experts.
—Jennie Rothenberg Gritz, Smithsonian Magazine, 30 Mar. 2023
The Tequesta were expert fishers who stretched nets across the Miami River and built barriers to funnel fish into their clutches.
—Sean Kingsley, Smithsonian Magazine, 29 Mar. 2023
Specifically, Avedon was expert at folding naturalism into artifice and maximizing the volume of both.
—Sebastian Smee, Washington Post, 25 Mar. 2023
Plus, keep reading for expert advice on how to use derma rollers to get the best results.
—ELLE, 24 Mar. 2023
Sanderson’s attorneys and expert medical witnesses described how his injuries were likely caused by someone crashing into him from behind.
—Sam Metz, ajc, 24 Mar. 2023
Putnam built studios to his expert specifications and fitted them with tech-forward recording equipment.
—Lily Moayeri, Variety, 22 Mar. 2023
Building a vision and purpose for your wealth is a journey that can last a lifetime and can require expert advice adaptable to change—but these are central to delivering a long-lasting legacy, which is more than just passing on money or property.
—Standard Chartered Bank, Forbes, 16 Mar. 2023
The theatrical craftsmanship is typically expert.
—Brian Seibert, New York Times, 2 Mar. 2023
Patients can ask their doctor to call the county Health Department to get connected to toxicologists who can provide expert advice, Vanderhoff said.
—Aya Elamroussi, CNN, 23 Feb. 2023
According to the Louisville National Weather Service, a heat wave that began in earnest Monday afternoon is the result of dry southern winds descending on the area, and residents should expert temperatures between 90 and 100 throughout the coming weeks.
—Thomas Birmingham, The Courier-Journal, 13 June 2022
Toby Grey contributes as a How To expert for BGR.
—Toby Grey, BGR, 24 May 2022
Medium-impact activities are somewhere in between, such as more intense cycling, intermediate to expert hikes and elliptical training, to name a few.
—Nicola Fumo, The Hollywood Reporter, 20 Jan. 2023
Rather than a full head of highlights distributed uniformly through the hair, French women prefer to get their hair colored with a more freestyle (but still expert) touch.
—Hannah Coates, Vogue, 3 Jan. 2023
Its slopes, which cover 1,200 acres, are considered advanced to expert backcountry routes.
—Doha Madani, NBC News, 27 Dec. 2022
But to expert observers, that seemed complex — and worth seeking specifics to understand what was a significant change in business and what was simply rhetoric, perhaps helpful in the height of 2020 protests but lacking lasting financial impact.
—Emily Flitter, New York Times, 21 Oct. 2022
And number two, everyone in this city is a savant or expert on one very specific thing.
—Los Angeles Times, 16 Nov. 2022
In finding the best dog treats, our product experts sifted through countless five-star options, chatted with real pet parents and spoke to expert Megan Conrad, MBBS, a veterinarian at Hello Ralphie and associate vet at WellHaven Pet Health.
—Jamie Spain, Good Housekeeping, 1 Nov. 2022
See More
These examples are programmatically compiled from various online sources to illustrate current usage of the word ‘expert.’ Any opinions expressed in the examples do not represent those of Merriam-Webster or its editors. Send us feedback about these examples.
- Top Definitions
- Synonyms
- Quiz
- Related Content
- Examples
- British
This shows grade level based on the word’s complexity.
[ noun, verb ek-spurt; adjective ek-spurt, ik-spurt ]
/ noun, verb ˈɛk spɜrt; adjective ˈɛk spɜrt, ɪkˈspɜrt /
This shows grade level based on the word’s complexity.
noun
a person who has special skill or knowledge in some particular field; specialist; authority: a language expert.
Military.
- the highest rating in rifle marksmanship, above that of marksman and sharpshooter.
- a person who has achieved such a rating.
adjective
possessing special skill or knowledge; trained by practice; skillful or skilled (often followed by in or at): an expert driver; to be expert at driving a car.
pertaining to, coming from, or characteristic of an expert: expert work; expert advice.
verb (used with object)
QUIZ
CAN YOU ANSWER THESE COMMON GRAMMAR DEBATES?
There are grammar debates that never die; and the ones highlighted in the questions in this quiz are sure to rile everyone up once again. Do you know how to answer the questions that cause some of the greatest grammar debates?
Which sentence is correct?
Origin of expert
1325–75; Middle English (adj.) <Latin expertus, past participle of experīrī to try, experience
synonym study for expert
OTHER WORDS FROM expert
ex·pert·ly, adverbex·pert·ness, nounnon·ex·pert, noun, adjectivepro·ex·pert, adjective
un·ex·pert, adjective
Words nearby expert
experimental psychology, experimental theater, experimentation, experimenter effect, experiment station, expert, expertise, expertism, expertize, expert system, expert witness
Dictionary.com Unabridged
Based on the Random House Unabridged Dictionary, © Random House, Inc. 2023
Words related to expert
adept, adroit, deft, experienced, skilled, skillful, trained, artist, authority, professional, crack, crackerjack, handy, savvy, sharp, slick, virtuoso, ace, artiste, buff
How to use expert in a sentence
-
Postal workers and independent experts say that has caused mail to pile up in post offices and caused multiday delays in localities across the country.
-
She added that she felt Pence’s top officials often showed derision toward the administration’s medical experts.
-
His suspicions are out of step with the views of election experts and many within his own party, who are building large-scale vote-by-mail programs.
-
Unless we have a dermatologist, a doctor, an expert co-sign that product, we don’t cover it.
-
States have broad power — known as “police power” — to protect public health in an emergency, even when doing so infringes on individual liberties, legal experts say.
-
I went into the audition as Fericito, the Venezuelan percussionist, and then I did a self-defense expert.
-
“He was a brave field commander and an expert in intelligence, and in organizing popular and tribal forces,” said the eulogist.
-
Well, one expert I talked to said that physically it involves little more than a $20 cable.
-
An expert in education talks about race relations, the political environment and what can be done to improve things.
-
Carter has also been a fixture on boards and expert panels, in think tanks and at universities.
-
And having an enormous appetite he was fortunate in being expert at finding angleworms.
-
He has his particular likings and tit-bits, and is very expert in carving out the parts of an animal that please him best.
-
But, as many people know, and all may believe, running in a crowded London street is difficult—even to an expert London thief.
-
When conversing recently with an expert on this subject I asked whether the use of asbestos would not effect the desired object.
-
His services as witness and expert adviser were in great request by railway companies.
British Dictionary definitions for expert
noun
a person who has extensive skill or knowledge in a particular field
adjective
skilful or knowledgeable
of, involving, or done by an expertan expert job
Derived forms of expert
expertly, adverbexpertness, noun
Word Origin for expert
C14: from Latin expertus known by experience, from experīrī to test; see experience
Collins English Dictionary — Complete & Unabridged 2012 Digital Edition
© William Collins Sons & Co. Ltd. 1979, 1986 © HarperCollins
Publishers 1998, 2000, 2003, 2005, 2006, 2007, 2009, 2012